PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g085040.1
Common NameMTR_1g085040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 370aa    MW: 41435.2 Da    PI: 7.4981
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g085040.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Medtr1g085040.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.12.3e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Medtr1g085040.1  67 RGAFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466891.28E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002492.6E-161461IPR001005SANT/Myb domain
CDDcd001676.07E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2565116IPR009057Homeodomain-like
SMARTSM007179.8E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.07166116IPR017930Myb domain
PfamPF002492.5E-1367111IPR001005SANT/Myb domain
CDDcd001675.81E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKRLRQSG  120
IDPNTHKPLS EVENDNEKSL TSNKTNQKGS VSSNEVMSLM IEPTKPSIEG YPLEVSTTSK  180
INNSSSSSHE LFLDTRFGSS SSYFSFQNLN YGSNIGISEN PNASSICFTP TSTSSQIMSD  240
TNSVITSNML HSVSPSIFST PTHVKPTVSV SSVDGVHNWE ASSYNNINNT NNGALPLQEE  300
MKWSEYLNTP FLMQNQPSPS MYTEAKPETG FITDESCTSW QQQQQQNFQL SDIYSKDLQR  360
FSVAFGQSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.241320.0root| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1484060.0AC148406.12 Medicago truncatula clone mth2-46e9, complete sequence.
GenBankAC2328690.0AC232869.5 Medicago truncatula clone mth2-13n12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591261.10.0myb transcription factor
TrEMBLG7IAD10.0G7IAD1_MEDTR; Myb transcription factor
STRINGGLYMA20G22230.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-107myb domain protein 61
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]